PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim01g007070.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 701aa    MW: 76787.6 Da    PI: 6.6848
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim01g007070.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.9e-094014381954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Sopim01g007070.0.1 401 FEHflHPYPKDSDKMMLAKQTGLTRSQVSNWFINARVR 438
                         554459******************************88 PP

2BELL113.41.2e-36265336172
                BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         erqe+q+kkakL+++l+eV++rY++y++q+q vi+  e++ag+gsak Yt+lAl++iS++FrcLkdai++qi
  Sopim01g007070.0.1 265 ERQEIQMKKAKLVNMLDEVEQRYRHYHHQMQSVINWLEQAAGIGSAKTYTALALQTISKQFRCLKDAIIGQI 336
                         79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-54189334IPR006563POX domain
PfamPF075269.4E-46196332IPR006563POX domain
PROSITE profilePS5007112.147379442IPR001356Homeobox domain
SMARTSM003899.7E-10382446IPR001356Homeobox domain
CDDcd000866.01E-13382443No hitNo description
SuperFamilySSF466895.99E-17383448IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28385448IPR009057Homeodomain-like
PfamPF059203.8E-18399438IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MASYFHGNSE IQEGNDGLQT LILMNPGYVG FSEAQHHHAP PPPPQGGGGS NIVFFNSNPL  60
GNSINLSHAP PPPPSQQQQF VGIPLATAAF TAPSQDSGNN NNNNESFSGL HGFLARSSPY  120
GFYNPANDIT AAREVTRAHQ QQQQGLSLSL SSSQQPSFGS FTAAREIVSS PTGSGSASGI  180
QQQQQQQQQS ICSVPLSSKY MKAAQELLDE VVNVGKSMKS SNSTEVVVYN DVKKSKNMVD  240
MDVQLDGVGP AEKDGAPTNE LSTAERQEIQ MKKAKLVNML DEVEQRYRHY HHQMQSVINW  300
LEQAAGIGSA KTYTALALQT ISKQFRCLKD AIIGQIRAAS KTLGEEDSLG GKIEGSRLKF  360
VDNQLRQQRA LQQLGMIQHN AWRPQRGLPE RAVSVLRAWL FEHFLHPYPK DSDKMMLAKQ  420
TGLTRSQVSN WFINARVRLW KPMVEEMYLE EIKEHEQNTL GQEKTSKVGE QNEDSTTSRS  480
IATQDKSPGS DSQKQDNPAS SIPMSNATSI PPIGMNIRNQ SAGFNLIGSP DIESINVTQG  540
SPKKPRSNEM LQHSPNSIPS INMDVKPNEE QMSMKFGDDR QDRDGFSLMG GPMNFMGGFG  600
AYPIGEIARF STEQFSAPYS TSGTVSLTLG LPHNENLSMS ATHHSFLPIP TQNVQIGEPN  660
HEFGSLNTPT SAHSTSNVYE NFNIQNRKRF AAPLLPDFVT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B3e-16388446563Homeobox protein Meis2
3k2a_A3e-16388446563Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004228612.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-154BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLK4ASS30.0K4ASS3_SOLLC; Uncharacterized protein
STRINGSolyc01g007070.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-130BEL1-like homeodomain 1